PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 293aa    MW: 33802.4 Da    PI: 5.0065
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42306.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
       KFK42306.1 16 RGPWSQEEDMKLITFIHKFGHENWRSLPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding53.55.5e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e +++++k +G++ W++Ia+ ++ gRt++++k+ w+++l
       KFK42306.1  69 RGNFTLEEEEEIIKLHKNYGNK-WSKIASQLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.5061163IPR017930Myb domain
SuperFamilySSF466891.54E-2914110IPR009057Homeodomain-like
SMARTSM007172.0E-131565IPR001005SANT/Myb domain
PfamPF002495.1E-151663IPR001005SANT/Myb domain
CDDcd001671.26E-91863No hitNo description
PROSITE profilePS5129426.23964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2767119IPR009057Homeodomain-like
SMARTSM007176.8E-1568116IPR001005SANT/Myb domain
PfamPF002493.2E-1569114IPR001005SANT/Myb domain
CDDcd001671.45E-582114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS QEEDMKLITF IHKFGHENWR SLPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTLEEEEEI IKLHKNYGNK WSKIASQLPG RTDNEIKNVW HTHLKKRLVQ  120
SSRTDLTSEE PTSPCSNDSV SRAKEDIAKE TEDSLNRKIS QDSTTSLSSN CSNHSNNEDD  180
LNIGGLMFEY SEFTDIIQEV DKPELLEIPF VSDPDDIWSF LDCSNAFANE NSSASRGEEE  240
SDEDEVKKWF KHLETELGLE EDDHNQQHKQ ETQENKESTS SSSLMKTYEL MIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1753441e-112AK175344.1 Arabidopsis thaliana mRNA for putative transcription factor (MYB63), complete cds, clone: RAFL21-78-M22.
GenBankAY5195721e-112AY519572.1 Arabidopsis thaliana MYB transcription factor (At1g79180) mRNA, complete cds.
GenBankBT0331251e-112BT033125.1 Arabidopsis thaliana unknown protein (At1g79180) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887770.11e-150hypothetical protein ARALYDRAFT_477086
TrEMBLA0A087HJK40.0A0A087HJK4_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.2__2216__AT1G79180.11e-150(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-123myb domain protein 63